- Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1151945
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,763 Da
- E Coli or Yeast
- 25569
- Uncharacterized protein HI_0650 (HI_0650)
Sequence
MIKIFIFLTALIVLSGCGSVVKLIDPTEKYTAYAGVAYDLEMAQQWGLPILDLPLSFLLDTVLLPYAWAQ